Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx3 Rabbit Polyclonal Antibody (HRP)

Alx3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6RW14

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Alx3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRP2 (Neuropilin-2, VEGF165R2, Vascular Endothelial Cell Growth Factor 165 Receptor 2, MGC126574, NP2, NPN2, PRO2714) (MaxLight 750) discontinued
130575-ML750 100 µL

NRP2 (Neuropilin-2, VEGF165R2, Vascular Endothelial Cell Growth Factor 165 Receptor 2, MGC126574, NP2, NPN2, PRO2714) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Adenylosuccinate lyase Antibody (HRP)
orb3156295 100 µg

Adenylosuccinate lyase Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein, N-His
YHD36101 100 μg

Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein, N-His

Sign In for Pricing
View Details
IgG2a, Rat Isotype Control (PE/CY5)
MBS655656-01 0.1 mg

IgG2a, Rat Isotype Control (PE/CY5)

Sign In for Pricing
View Details
IgG2a, Rat Isotype Control (PE/CY5)
MBS655656-02 5x 0.1 mg

IgG2a, Rat Isotype Control (PE/CY5)

Sign In for Pricing
View Details
Chicken orexinA (OXA) ELISA Kit
YP-W60454-01 48 Tests

Chicken orexinA (OXA) ELISA Kit

Sign In for Pricing
View Details