Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx3 Rabbit Polyclonal Antibody (HRP)

Alx3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6RW14

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Alx3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921154-01 48 Well

Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921154-02 96 Well

Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921154-03 5x 96 Well

Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit
MBS9921154-04 10x 96 Well

Bovine Zinc Finger Protein 658B (ZNF658B) ELISA Kit

Sign In for Pricing
View Details
Obfc1 ORF Vector (Mouse) (pORF)
ORF051890 1.0 µg DNA

Obfc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human Relaxin-1, RLN-1 ELISA Kit
MBS165949-01 48 Well

Human Relaxin-1, RLN-1 ELISA Kit

Sign In for Pricing
View Details