Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOCT Rabbit Polyclonal Antibody (HRP)

NOCT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NOC, CCR4L, Ccr4c, CCRN4L

UniProt

Q9UK39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036250

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial
MBS1455576-01 0.02 mg (Yeast)

Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial

Sign In for Pricing
View Details
Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial
MBS1455576-02 0.1 mg (Yeast)

Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial

Sign In for Pricing
View Details
Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial
MBS1455576-03 1 mg (Yeast)

Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial

Sign In for Pricing
View Details
Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial
MBS1455576-04 5x 1 mg (Yeast)

Recombinant Human Scavenger receptor cysteine-rich type 1 protein M130 (CD163) , partial

Sign In for Pricing
View Details
SALL1, NT (SALL1, SAL1, ZNF794, Sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1) (MaxLight 405)
MBS6344892-01 0.1 mL

SALL1, NT (SALL1, SAL1, ZNF794, Sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1) (MaxLight 405)

Sign In for Pricing
View Details
SALL1, NT (SALL1, SAL1, ZNF794, Sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1) (MaxLight 405)
MBS6344892-02 5x 0.1 mL

SALL1, NT (SALL1, SAL1, ZNF794, Sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1) (MaxLight 405)

Sign In for Pricing
View Details