Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF385 Rabbit Polyclonal Antibody (FITC)

ZNF385 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HZF, RZF, ZFP385, ZNF385

UniProt

Q96PM9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF385

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_056296

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCTD19 qPCR Primer Pair
QH64317S 200 Tests

Human KCTD19 qPCR Primer Pair

Sign In for Pricing
View Details
Huntingtin (HTT) CytoSection
TS418435P5 25 Slides

Huntingtin (HTT) CytoSection

Sign In for Pricing
View Details
BRSK1 CytoSection
TS411767P5 25 Slides

BRSK1 CytoSection

Sign In for Pricing
View Details
CCR 4 (C C chemokine receptor type 4, C C CKR 4, CC CKR 4, CCR 4, Chemokine (CC motif) receptor 4, chemokine C C motif receptor 4, ChemR13, CKR4, CMKBR 4, CMKBR4, HGCN 14099, K5 5, MGC88293) discontinued
C2099-68C 100 µg

CCR 4 (C C chemokine receptor type 4, C C CKR 4, CC CKR 4, CCR 4, Chemokine (CC motif) receptor 4, chemokine C C motif receptor 4, ChemR13, CKR4, CMKBR 4, CMKBR4, HGCN 14099, K5 5, MGC88293) discontinued

Sign In for Pricing
View Details
VPS39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2619505 3x 1.0 µg

VPS39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IL28 Receptor alpha (IFNLR1) (NM_173065) Human Tagged ORF Clone Lentiviral Particle
RC221789L3V 200 µL

IL28 Receptor alpha (IFNLR1) (NM_173065) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details