Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF385 Rabbit Polyclonal Antibody (Biotin)

ZNF385 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HZF, RZF, ZFP385, ZNF385

UniProt

Q96PM9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF385

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_056296

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti ADH5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8422244-01 0.001 mL

Rabbit Anti ADH5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti ADH5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8422244-02 5x 0.001 mL

Rabbit Anti ADH5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018523-01 0.02 mg

Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018523-02 0.1 mg

Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018523-03 5x 0.1 mg

Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
TMEM186 Double Nickase Plasmid (h)
sc-409868-NIC 20 µg

TMEM186 Double Nickase Plasmid (h)

Sign In for Pricing
View Details