Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATA3 Rabbit Polyclonal Antibody (HRP)

GATA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HDR, HDRS

UniProt

Q5VWG7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GATA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IF, IHC, WB

NCBI Accession Number

NP_001002295

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIPRL, CT (TIPRL, TIP41-like protein, Putative MAPK-activating protein PM10, Type 2A-interacting protein) (Biotin)
MBS6355692-01 0.2 mL

TIPRL, CT (TIPRL, TIP41-like protein, Putative MAPK-activating protein PM10, Type 2A-interacting protein) (Biotin)

Sign In for Pricing
View Details
TIPRL, CT (TIPRL, TIP41-like protein, Putative MAPK-activating protein PM10, Type 2A-interacting protein) (Biotin)
MBS6355692-02 5x 0.2 mL

TIPRL, CT (TIPRL, TIP41-like protein, Putative MAPK-activating protein PM10, Type 2A-interacting protein) (Biotin)

Sign In for Pricing
View Details
Fibroblast Growth Factor-Basic Mouse Recombinant (FGF 2 Mouse)
PT_40563-01 10 µg

Fibroblast Growth Factor-Basic Mouse Recombinant (FGF 2 Mouse)

Sign In for Pricing
View Details
Fibroblast Growth Factor-Basic Mouse Recombinant (FGF 2 Mouse)
PT_40563-02 50 µg

Fibroblast Growth Factor-Basic Mouse Recombinant (FGF 2 Mouse)

Sign In for Pricing
View Details
Fibroblast Growth Factor-Basic Mouse Recombinant (FGF 2 Mouse)
PT_40563-03 1 mg

Fibroblast Growth Factor-Basic Mouse Recombinant (FGF 2 Mouse)

Sign In for Pricing
View Details
Lentiviral human SLFN12L sgRNA gene knockout kit - Lentiviral human SLFN12L sgRNA gene knockout kit (plasmid)
GTR15393086 1 Vial

Lentiviral human SLFN12L sgRNA gene knockout kit - Lentiviral human SLFN12L sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details