Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBX2 Rabbit Polyclonal Antibody (HRP)

GBX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P52951

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GBX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001476

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TROP2 Antibody / TACSTD2
V3857-100UG 100 µg

TROP2 Antibody / TACSTD2

Sign In for Pricing
View Details
Collagen 4 alpha 4 Antibody
orb737357 100 µL

Collagen 4 alpha 4 Antibody

Sign In for Pricing
View Details
Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (PE)
131159-PE 100 µL

Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (PE)

Sign In for Pricing
View Details
Recombinant Bovine Glia maturation factor gamma (GMFG)
MBS1351852-01 0.02 mg (E-Coli)

Recombinant Bovine Glia maturation factor gamma (GMFG)

Sign In for Pricing
View Details
Recombinant Bovine Glia maturation factor gamma (GMFG)
MBS1351852-02 0.1 mg (E-Coli)

Recombinant Bovine Glia maturation factor gamma (GMFG)

Sign In for Pricing
View Details
Recombinant Bovine Glia maturation factor gamma (GMFG)
MBS1351852-03 0.02 mg (Yeast)

Recombinant Bovine Glia maturation factor gamma (GMFG)

Sign In for Pricing
View Details