Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHX6 Rabbit Polyclonal Antibody (HRP)

LHX6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LHX6.1

UniProt

Q9UPM6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFCAB14 siRNA (Human)
MBS8228788-01 15 nmol

EFCAB14 siRNA (Human)

Sign In for Pricing
View Details
EFCAB14 siRNA (Human)
MBS8228788-02 30 nmol

EFCAB14 siRNA (Human)

Sign In for Pricing
View Details
EFCAB14 siRNA (Human)
MBS8228788-03 5x 30 nmol

EFCAB14 siRNA (Human)

Sign In for Pricing
View Details
FCRL1 (Fc Receptor-like Protein 1, FcR-like Protein 1, FcRL1, Fc Receptor Homolog 1, FcRH1, IFGP Family Protein 1, hIFGP1, Immune Receptor Translocation-associated Protein 5, CD307a, FCRH1, IFGP1, IRTA5, DKFZp667O1421) (MaxLight 650)
137949-ML650 100 µL

FCRL1 (Fc Receptor-like Protein 1, FcR-like Protein 1, FcRL1, Fc Receptor Homolog 1, FcRH1, IFGP Family Protein 1, hIFGP1, Immune Receptor Translocation-associated Protein 5, CD307a, FCRH1, IFGP1, IRTA5, DKFZp667O1421) (MaxLight 650)

Sign In for Pricing
View Details
KCNJ11, NT (KCNJ11, ATP-sensitive inward rectifier potassium channel 11, IKATP, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 490) discontinued
037322-ML490 100 µL

KCNJ11, NT (KCNJ11, ATP-sensitive inward rectifier potassium channel 11, IKATP, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Human Carbonic Anhydrase II / CA2 Protein (His tag)
ARP6670-01 10 µg

Recombinant Human Carbonic Anhydrase II / CA2 Protein (His tag)

Sign In for Pricing
View Details