Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPAS4 Rabbit Polyclonal Antibody (FITC)

NPAS4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NXF, Le-PAS, PASD10, bHLHe79

UniProt

Q8IUM7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NPAS4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_849195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit
KTB1128-01 48 Tests - 48 Samples

CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit

Sign In for Pricing
View Details
CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit
KTB1128-02 96 Tests - 96 Samples

CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit

Sign In for Pricing
View Details
ATOH1 (Protein Atonal Homolog 1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, Helix-loop-helix Protein hATH-1, hATH1, ATH1, BHLHA14) discontinued
359833-01 50 µL

ATOH1 (Protein Atonal Homolog 1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, Helix-loop-helix Protein hATH-1, hATH1, ATH1, BHLHA14) discontinued

Sign In for Pricing
View Details
ATOH1 (Protein Atonal Homolog 1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, Helix-loop-helix Protein hATH-1, hATH1, ATH1, BHLHA14) discontinued
359833-02 100 µL

ATOH1 (Protein Atonal Homolog 1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, Helix-loop-helix Protein hATH-1, hATH1, ATH1, BHLHA14) discontinued

Sign In for Pricing
View Details
TRNAV37P Protein Lysate (Human) with C-Ha Tag
48456031 100 µg

TRNAV37P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Mouse DPPIV/CD26 CF
954-SE-010 10 µg

Recombinant Mouse DPPIV/CD26 CF

Sign In for Pricing
View Details