Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKX Rabbit Polyclonal Antibody (Biotin)

MKX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IFRX, IRXL1, C10orf48

UniProt

Q8IYA7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MKX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_775847

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)
MBS2099113-01 5x 96 Tests

Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)
MBS2099113-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)
MBS2099113-03 10x 96 Tests

Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)
MBS2099113-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Matrix Metalloproteinase 9 (MMP9) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
ExoFACS™ Kit for Saliva Exosomes
K1234-20 20 Reactions

ExoFACS™ Kit for Saliva Exosomes

Sign In for Pricing
View Details
Uridine 5'-diphosphate disodium salt
NU03399-01 2 g

Uridine 5'-diphosphate disodium salt

Sign In for Pricing
View Details