Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF621 Rabbit Polyclonal Antibody (Biotin)

ZNF621 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6ZSS3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF621

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_940886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAZ Double Nickase Plasmid (m2)
sc-430168-NIC-2 20 µg

TAZ Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Cytokeratin 15 (KRT15) Rabbit Polyclonal Antibody
TA313116 100 µL

Cytokeratin 15 (KRT15) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
THOC2 CRISPR Activation Plasmid (h)
sc-407567-ACT 20 µg

THOC2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Btbd35f20 Mouse qPCR Primer Pair (NM_001085553)
MP219259 200 Reactions

Btbd35f20 Mouse qPCR Primer Pair (NM_001085553)

Sign In for Pricing
View Details
Human Mdm2 p53 Binding Protein Homolog (MDM2) ELISA Kit
MBS2706222-01 24 Strip Well

Human Mdm2 p53 Binding Protein Homolog (MDM2) ELISA Kit

Sign In for Pricing
View Details
Human Mdm2 p53 Binding Protein Homolog (MDM2) ELISA Kit
MBS2706222-02 48 Well

Human Mdm2 p53 Binding Protein Homolog (MDM2) ELISA Kit

Sign In for Pricing
View Details