Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT7 Rabbit Polyclonal Antibody (FITC)

CNOT7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CAF1, CAF-1, Caf1a, hCAF-1

UniProt

Q9UIV1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CNOT7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Albumin (BCP) Microplate Assay Kit
ASK1151 100 Assays

Albumin (BCP) Microplate Assay Kit

Sign In for Pricing
View Details
Zc3h4 siRNA Oligos set (Mouse)
50746174 3x 5 nmol

Zc3h4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
KMT5C Human Over-expression Lysate
orb1351747 100 µg

KMT5C Human Over-expression Lysate

Sign In for Pricing
View Details
2'- O- (6- Aminohexylcarbamoyl)guanosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-2'-AHC-cGMPS)
MBS256280-01 5 µmol

2'- O- (6- Aminohexylcarbamoyl)guanosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-2'-AHC-cGMPS)

Sign In for Pricing
View Details
2'- O- (6- Aminohexylcarbamoyl)guanosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-2'-AHC-cGMPS)
MBS256280-02 5x 5 µmol

2'- O- (6- Aminohexylcarbamoyl)guanosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer (Rp-2'-AHC-cGMPS)

Sign In for Pricing
View Details
Lentiviral mouse Pacs2 shRNA (UAS) - Lentiviral mouse Pacs2 shRNA (UAS) (25)
GTR15133505 1 Vial

Lentiviral mouse Pacs2 shRNA (UAS) - Lentiviral mouse Pacs2 shRNA (UAS) (25)

Sign In for Pricing
View Details