Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT7 Rabbit Polyclonal Antibody (HRP)

CNOT7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAF1, CAF-1, Caf1a, hCAF-1

UniProt

Q9UIV1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CNOT7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG12 siRNA (Human)
CRJ2303-01 15 nmol

ALG12 siRNA (Human)

Sign In for Pricing
View Details
ALG12 siRNA (Human)
CRJ2303-02 30 nmol

ALG12 siRNA (Human)

Sign In for Pricing
View Details
Anti-Zebrafish FASN Antibody Picoband® Cy3 Conjugated
AZE7F5V3-Cy3 100 µg/Vial

Anti-Zebrafish FASN Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Tissue RNA Auto Plate
301368 96 Tests

Tissue RNA Auto Plate

Sign In for Pricing
View Details
Epac2 Rabbit pAb, IRDye 800CW conjugated
orb2871381 100 µL

Epac2 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Human CTSR1-Strep full length protein-synthetic nanodisc
MBS1883655-01 0.01 mg

Human CTSR1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details