Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCLS1 Rabbit Polyclonal Antibody (Biotin)

HCLS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HS1, p75, CTTNL, lckBP1

UniProt

P14317

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005326

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAP3K8 (Ser400) Rabbit Polyclonal Antibody (PerCP)
orb1581755 100 µL

Phospho-MAP3K8 (Ser400) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
RUNX1T1 Protein Vector (Mouse) (pPM-C-His)
PV226233 500 ng

RUNX1T1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody
abx301382-01 20 µg

Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody

Sign In for Pricing
View Details
Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody
abx301382-02 50 µg

Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody

Sign In for Pricing
View Details
Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody
abx301382-03 100 µg

Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody

Sign In for Pricing
View Details
Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody
abx301382-04 200 µg

Leucine Rich Repeat Containing Protein 32 (LRRC32) Antibody

Sign In for Pricing
View Details