Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCLS1 Rabbit Polyclonal Antibody (Biotin)

HCLS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HS1, p75, CTTNL, lckBP1

UniProt

P14317

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005326

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOD1 Rabbit Polyclonal Antibody (HRP)
orb2117657 100 µL

SOD1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DUX3 Polyclonal Antibody, Cy3 Conjugated
bs-9664R-Cy3 100 µL

DUX3 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-01 48 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-02 96 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-03 5x 96 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-04 10x 96 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details