Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnip3 Rabbit Polyclonal Antibody (FITC)

Kcnip3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cs, DRE, Csen, KChI, DREAM, R7484, KChIP3, R74849, AI413860, 4933407H12Rik

UniProt

Q9QXT8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PMSMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001104801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFRB Mouse mAb
64066 100 µL

PDGFRB Mouse mAb

Sign In for Pricing
View Details
VWA7 Human shRNA Plasmid Kit (Locus ID 80737)
TL305794 1 Kit

VWA7 Human shRNA Plasmid Kit (Locus ID 80737)

Sign In for Pricing
View Details
Human Cellular retinoic acid-binding protein 1
orb1476552-01 50 µg

Human Cellular retinoic acid-binding protein 1

Sign In for Pricing
View Details
Human Cellular retinoic acid-binding protein 1
orb1476552-02 500 µg

Human Cellular retinoic acid-binding protein 1

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri hisA Protein (aa 1-238) (strain NBRC 12016)
VAng-Lsx9583-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Kluyveri hisA Protein (aa 1-238) (strain NBRC 12016)

Sign In for Pricing
View Details
MCT12 CRISPR Activation Plasmid (m2)
sc-433777-ACT-2 20 µg

MCT12 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details