Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC1 Rabbit Polyclonal Antibody (HRP)

CXXC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik

UniProt

Q9P0U4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXXC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pip4k2c Rat shRNA Lentiviral Particle (Locus ID 140607)
TL712433V 500 µL Each

Pip4k2c Rat shRNA Lentiviral Particle (Locus ID 140607)

Sign In for Pricing
View Details
TNR19 Rabbit Polyclonal Antibody
E28PN2284 100 µL

TNR19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-hnRNP-K IHC Antibody, Affinity Purified
MBS3907445-01 0.005 mg

Rabbit anti-hnRNP-K IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-hnRNP-K IHC Antibody, Affinity Purified
MBS3907445-02 5x 0.0005 mg

Rabbit anti-hnRNP-K IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-hnRNP-K IHC Antibody, Affinity Purified
MBS3907445-03 5x 0.005 mg

Rabbit anti-hnRNP-K IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
HSH2D sgRNA CRISPR Lentivector (Human) (Target 2)
K0995803 1.0 µg DNA

HSH2D sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details