Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mnx1 Rabbit Polyclonal Antibody (HRP)

Mnx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MN, HB9, Hlxb, MNR2, Hlxb9

UniProt

A2RSX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Mnx1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr951 Rabbit Polyclonal Antibody
AP01718PU-N 100 µg

VEGF Receptor 2 (KDR) pTyr951 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPL21 Antibody
8C14066-AAT 50 µg

MRPL21 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS512333 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
1,2-Dihydroperillic Acid
TRC-D454688-10MG 10 mg

1,2-Dihydroperillic Acid

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF647 conjugate, 0.1mg/mL
BNC471777-100 1x 100 µL

Prostate Specific Antigen (PSA) (3E6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details