Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR4A1 Rabbit Polyclonal Antibody (FITC)

NR4A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HMR, N10, TR3, NP10, GFRP1, NAK-1, NGFIB, NUR77

UniProt

P22736

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NR4A1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS509642 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
KEL Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8E1]
TA811548AM 100 µL

KEL Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8E1]

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3306), CF647 conjugate, 0.1mg/mL
BNC473306-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3306), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C9orf25 (FAM219A) (NM_001184945) Human Over-expression Lysate
LC432602 20 µg

C9orf25 (FAM219A) (NM_001184945) Human Over-expression Lysate

Sign In for Pricing
View Details
Acetoin (~90%)
TRC-A163778-5G 5 g

Acetoin (~90%)

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL
BNCB2434-500 1x 500 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details