Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF4A Rabbit Polyclonal Antibody (HRP)

HNF4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCF, HNF4, MODY, FRTS4, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha

UniProt

P41235

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HNF4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_787110

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ralstonia metallidurans DNA-directed RNA polymerase subunit beta'(rpoC), partial
MBS1411630 Inquire

Recombinant Ralstonia metallidurans DNA-directed RNA polymerase subunit beta'(rpoC), partial

Sign In for Pricing
View Details
Nucleophosmin mouse mAb(ABT358)
UB-GEN-15104 100 µL

Nucleophosmin mouse mAb(ABT358)

Sign In for Pricing
View Details
Pfdn1 ORF Vector (Rat) (pORF)
ORF073376 1.0 µg DNA

Pfdn1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
SLITRK2 (NM_001144010) Human Untagged Clone
SC325360 10 µg

SLITRK2 (NM_001144010) Human Untagged Clone

Sign In for Pricing
View Details
Atoh7 AAV siRNA Pooled Vector
12653166 1.0 µg

Atoh7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit IgG F (ab') 2 Antibody - Texas Red Conjugated
OARA05597-2MG 2 mg

Rabbit IgG F (ab') 2 Antibody - Texas Red Conjugated

Sign In for Pricing
View Details