Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa6 Rabbit Polyclonal Antibody (FITC)

Hoxa6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hox-1., Hox-1.2

UniProt

P09092

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pik3r6 3'UTR GFP Stable Cell Line
TU266261 1.0 mL

Pik3r6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit
MBS728627-01 48 Strip Well (Competitive)

Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit

Sign In for Pricing
View Details
Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit
MBS728627-02 48 Strip Well (Sandwich)

Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit

Sign In for Pricing
View Details
Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit
MBS728627-03 96 Strip Well (Competitive)

Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit

Sign In for Pricing
View Details
Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit
MBS728627-04 96 Strip Well (Sandwich)

Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit

Sign In for Pricing
View Details
Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit
MBS728627-05 5x 96 Strip Well (Competitive)

Mouse Granulocyte-Macrophage Colony-Stimulating Factor ELISA Kit

Sign In for Pricing
View Details