Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa6 Rabbit Polyclonal Antibody (HRP)

Hoxa6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-1., Hox-1.2

UniProt

P09092

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1542 Protein Vector (Rat) (pPM-C-HA)
34022026 500 ng

Olr1542 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MAPK3 Recombinant Protein (Rat)
RP210818 100 µg

MAPK3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
PI4KA Antibody
DF12696-01 100 µL

PI4KA Antibody

Sign In for Pricing
View Details
PI4KA Antibody
DF12696-02 200 µL

PI4KA Antibody

Sign In for Pricing
View Details
Human CRN (Corin) ELISA Kit
EK240842 96 Well

Human CRN (Corin) ELISA Kit

Sign In for Pricing
View Details
Bbs9 (NM_181316) Mouse Tagged ORF Clone Lentiviral Particle
MR224929L4V 200 µL

Bbs9 (NM_181316) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details