Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc12 Rabbit Polyclonal Antibody (HRP)

Hoxc12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-3., Hox-3.8

UniProt

Q8K5B8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034593

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN7 Antibody, FITC conjugated
A62112-100UG 100 µg

NSUN7 Antibody, FITC conjugated

Sign In for Pricing
View Details
Gadd45gip1 (NM_001100504) Rat Untagged Clone
RN202896 10 µg

Gadd45gip1 (NM_001100504) Rat Untagged Clone

Sign In for Pricing
View Details
GPD2 antibody
39043 100 µL

GPD2 antibody

Sign In for Pricing
View Details
Putative protocadherin β-18 (PCDHB18) Human ELISA Kit
G5539 96 Tests

Putative protocadherin β-18 (PCDHB18) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Lathyrus sativus Mannose/glucose-specific lectin alpha chain
MBS1071182-01 0.02 mg (E-Coli)

Recombinant Lathyrus sativus Mannose/glucose-specific lectin alpha chain

Sign In for Pricing
View Details
Recombinant Lathyrus sativus Mannose/glucose-specific lectin alpha chain
MBS1071182-02 0.1 mg (E-Coli)

Recombinant Lathyrus sativus Mannose/glucose-specific lectin alpha chain

Sign In for Pricing
View Details