Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD1 Rabbit Polyclonal Antibody (Biotin)

HOXD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX4, HOX4G, Hox-4.7

UniProt

Q9GZZ0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2N Antibody (HRP)
orb415790-01 50 µg

UBE2N Antibody (HRP)

Sign In for Pricing
View Details
UBE2N Antibody (HRP)
orb415790-02 100 µg

UBE2N Antibody (HRP)

Sign In for Pricing
View Details
ZNF383, NT (ZNF383, Zinc finger protein 383) (MaxLight 490) discontinued
044212-ML490 100 µL

ZNF383, NT (ZNF383, Zinc finger protein 383) (MaxLight 490) discontinued

Sign In for Pricing
View Details
FOSB (Protein fosB, G0/G1 Switch Regulatory Protein 3, G0S3) (MaxLight 405) discontinued
126929-ML405 100 µL

FOSB (Protein fosB, G0/G1 Switch Regulatory Protein 3, G0S3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human FLG2 qPCR Primer Pair
QH75465S 200 Tests

Human FLG2 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral mouse Gclc shRNA (UAS) - Lentiviral mouse Gclc shRNA (UAS, GFP) plasmid
GTR15297877 1 Vial

Lentiviral mouse Gclc shRNA (UAS) - Lentiviral mouse Gclc shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details