Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD12 Rabbit Polyclonal Antibody (FITC)

HOXD12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX4H

UniProt

P35452

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXD12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_067016

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAIF1 polyclonal antibody
BS72546-01 50 µL

NAIF1 polyclonal antibody

Sign In for Pricing
View Details
NAIF1 polyclonal antibody
BS72546-02 100 µL

NAIF1 polyclonal antibody

Sign In for Pricing
View Details
Rat Myh9 Pre-designed siRNA Set B
SI208912B 1 Each

Rat Myh9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (APC)
135649-APC 100 µL

ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (APC)

Sign In for Pricing
View Details
Cathepsin L HC peptide
orb234420-01 1 mg

Cathepsin L HC peptide

Sign In for Pricing
View Details
Cathepsin L HC peptide
orb234420-02 5 mg

Cathepsin L HC peptide

Sign In for Pricing
View Details