Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Evx2 Rabbit Polyclonal Antibody (HRP)

Evx2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Evx2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRLPSAPLHGALGDLPAKGKFEIDTLFNLQHPSSESTVSSEIASATESRK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_221512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY2G Protein Vector (Rat) (pPM-C-His)
PV272065 500 ng

GUCY2G Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
LOC401260 Protein Vector (Human) (pPM-C-His)
PV054628 500 ng

LOC401260 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SPINK1 Antibody
MBS7049212-01 0.05 mg

SPINK1 Antibody

Sign In for Pricing
View Details
SPINK1 Antibody
MBS7049212-02 0.1 mg

SPINK1 Antibody

Sign In for Pricing
View Details
SPINK1 Antibody
MBS7049212-03 5x 0.1 mg

SPINK1 Antibody

Sign In for Pricing
View Details
Carbonyl Reductase 3 Polyclonal Antibody
RA22693-01 50 µL

Carbonyl Reductase 3 Polyclonal Antibody

Sign In for Pricing
View Details