Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF391 Rabbit Polyclonal Antibody (FITC)

ZNF391 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DJ153G14.3

UniProt

Q9UJN7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF391

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HTQERPYKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFSWISSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001070249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I (Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY) discontinued
H6205-70G 50 µg

HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I (Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY) discontinued

Sign In for Pricing
View Details
3- (Benzyloxy) cyclobutanone
423077-01 1 g

3- (Benzyloxy) cyclobutanone

Sign In for Pricing
View Details
3- (Benzyloxy) cyclobutanone
423077-02 5 g

3- (Benzyloxy) cyclobutanone

Sign In for Pricing
View Details
Factor VIII Related Antigen (vWF, Factor VIII Related Antigen) (FITC) discontinued
F0016-13-FITC 100 µL

Factor VIII Related Antigen (vWF, Factor VIII Related Antigen) (FITC) discontinued

Sign In for Pricing
View Details
PBS with calcium and magnesium 1X
LSGPBS-001A 500 mL

PBS with calcium and magnesium 1X

Sign In for Pricing
View Details
Epsin 1 Rabbit Polyclonal Antibody (BF350)
orb2527928 100 µL

Epsin 1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details