Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP57 Rabbit Polyclonal Antibody (HRP)

ZFP57 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TNDM1, ZNF698, C6orf40, bA145L22, bA145L22.2

UniProt

Q9NU63

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZFP57

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYCP3 Antibody (SCP3)
R30137 100 µg

SYCP3 Antibody (SCP3)

Sign In for Pricing
View Details
Porcine TGFb2 ELISA Kit
orb437496-01 48 Tests

Porcine TGFb2 ELISA Kit

Sign In for Pricing
View Details
Porcine TGFb2 ELISA Kit
orb437496-02 96 Tests

Porcine TGFb2 ELISA Kit

Sign In for Pricing
View Details
PrmA Antibody
orb824680 2 mg

PrmA Antibody

Sign In for Pricing
View Details
FASN Protein Vector (Rat) (pPM-C-His)
PV267833 500 ng

FASN Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human PDZD2 Knockout A549 cell line
GTR15403669 1 Vial

Human PDZD2 Knockout A549 cell line

Sign In for Pricing
View Details