Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF589 Rabbit Polyclonal Antibody (HRP)

ZNF589 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SZF1

UniProt

Q86UQ0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF589

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (PMT2), partial
CSB-EP329067SVG-01 20 µg

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (PMT2), partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (PMT2), partial
CSB-EP329067SVG-02 100 µg

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (PMT2), partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (PMT2), partial
CSB-EP329067SVG-03 1 mg

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 2 (PMT2), partial

Sign In for Pricing
View Details
ARL11 Over-expression Lysate Product
GWB-F03840 0.1 mg

ARL11 Over-expression Lysate Product

Sign In for Pricing
View Details
Rat Crcp/DNA-directed RNA polymerase III subunit RPC9 ELISA Kit
E0227Ra 96 Tests

Rat Crcp/DNA-directed RNA polymerase III subunit RPC9 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polymorphonuclear Elastase, PMN ELASTASE ELISA KIT
E0234Rb-01 48 Well

Rabbit Polymorphonuclear Elastase, PMN ELASTASE ELISA KIT

Sign In for Pricing
View Details