Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSM1 Rabbit Polyclonal Antibody (HRP)

INSM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IA1, IA-1

UniProt

Q01101

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human INSM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQAKGAPLAPPAEDLLALYPGPDEKAPQEAAGDGEGAGVLGLSASAECHL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_002187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pepinemab (SEMA4D)
592107 100 µg

Pepinemab (SEMA4D)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-3153-Off Virus
mh5475 1.0 mL

AdmiRa-hsa-miR-3153-Off Virus

Sign In for Pricing
View Details
Kinesis SuperFlangeless Nut 1/16in PPS
CHR3945 1 Each

Kinesis SuperFlangeless Nut 1/16in PPS

Sign In for Pricing
View Details
TINAGL1, CT (TINAGL1, GIS5, LCN7, OLRG2, TINAGL, Tubulointerstitial nephritis antigen-like, Glucocorticoid-inducible protein 5, Oxidized LDL-responsive gene 2 protein, Tubulointerstitial nephritis antigen-related protein) (AP)
MBS6355657-01 0.2 mL

TINAGL1, CT (TINAGL1, GIS5, LCN7, OLRG2, TINAGL, Tubulointerstitial nephritis antigen-like, Glucocorticoid-inducible protein 5, Oxidized LDL-responsive gene 2 protein, Tubulointerstitial nephritis antigen-related protein) (AP)

Sign In for Pricing
View Details
TINAGL1, CT (TINAGL1, GIS5, LCN7, OLRG2, TINAGL, Tubulointerstitial nephritis antigen-like, Glucocorticoid-inducible protein 5, Oxidized LDL-responsive gene 2 protein, Tubulointerstitial nephritis antigen-related protein) (AP)
MBS6355657-02 5x 0.2 mL

TINAGL1, CT (TINAGL1, GIS5, LCN7, OLRG2, TINAGL, Tubulointerstitial nephritis antigen-like, Glucocorticoid-inducible protein 5, Oxidized LDL-responsive gene 2 protein, Tubulointerstitial nephritis antigen-related protein) (AP)

Sign In for Pricing
View Details
ELMOD3 siRNA (Mouse)
CRN2971-01 15 nmol

ELMOD3 siRNA (Mouse)

Sign In for Pricing
View Details