Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM6 Rabbit Polyclonal Antibody (Biotin)

RBM6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

3G2, g16, DEF3, DEF-3, HLC-11, NY-LU-12

UniProt

B4E0G6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human RBM6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YGQSKSFPEGKTARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPEDATKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001161054.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spert sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6472405 3x 1.0 µg

Spert sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Chd2 (NM_001081345) Mouse Tagged ORF Clone
MG215336 10 µg

Chd2 (NM_001081345) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Kynurenine 3-Monooxygenase/KMO Antibody [Alexa Fluor 532]
NBP2-97709AF532 0.1 mL

Rabbit Polyclonal Kynurenine 3-Monooxygenase/KMO Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Pam16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
35974114 3x 1.0 µg

Pam16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Chicken Matrix Metalloproteinase 1 (MMP1) ELISA Kit
abx355530 96 Well

Chicken Matrix Metalloproteinase 1 (MMP1) ELISA Kit

Sign In for Pricing
View Details
NFATC3 Polyclonal Antibody
RD77527A-01 20 µL

NFATC3 Polyclonal Antibody

Sign In for Pricing
View Details