Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smad6 Rabbit Polyclonal Antibody (Biotin)

Smad6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Madh, Madh6, b2b390C, b2b390Clo

UniProt

O35182

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Smad6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RPE65 Antibody (401.8B11.3D9) [DyLight 680]
NB100-355FR 0.2 mL

Mouse Monoclonal RPE65 Antibody (401.8B11.3D9) [DyLight 680]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) WCAM Polyclonal Antibody
MBS7149039 Inquire

Rabbit anti-Escherichia coli (strain K12) WCAM Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Membrane protein FAM159B, FAM159B ELISA Kit
MBS9323097-01 48 Well

Bovine Membrane protein FAM159B, FAM159B ELISA Kit

Sign In for Pricing
View Details
Bovine Membrane protein FAM159B, FAM159B ELISA Kit
MBS9323097-02 96 Well

Bovine Membrane protein FAM159B, FAM159B ELISA Kit

Sign In for Pricing
View Details
Bovine Membrane protein FAM159B, FAM159B ELISA Kit
MBS9323097-03 5x 96 Well

Bovine Membrane protein FAM159B, FAM159B ELISA Kit

Sign In for Pricing
View Details
Bovine Membrane protein FAM159B, FAM159B ELISA Kit
MBS9323097-04 10x 96 Well

Bovine Membrane protein FAM159B, FAM159B ELISA Kit

Sign In for Pricing
View Details