Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD6 Rabbit Polyclonal Antibody (HRP)

SMAD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AOVD2, MADH6, MADH7, HsT17432

UniProt

O43541

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genesig kit for Acinetobacter baumannii, Easy
348315 1 Kit

Genesig kit for Acinetobacter baumannii, Easy

Sign In for Pricing
View Details
Anti-Adrenergic Receptor Alpha 2C (ADRA2C) Polyclonal antibody
FY-AB38639-01 1 mL

Anti-Adrenergic Receptor Alpha 2C (ADRA2C) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Adrenergic Receptor Alpha 2C (ADRA2C) Polyclonal antibody
FY-AB38639-02 100 µL

Anti-Adrenergic Receptor Alpha 2C (ADRA2C) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Adrenergic Receptor Alpha 2C (ADRA2C) Polyclonal antibody
FY-AB38639-03 200 µL

Anti-Adrenergic Receptor Alpha 2C (ADRA2C) Polyclonal antibody

Sign In for Pricing
View Details
Anti Human FLK Pab
111462 100 µg

Anti Human FLK Pab

Sign In for Pricing
View Details
(R) -1-Methyl-3-pyrrolidinol
284819-01 500 mg

(R) -1-Methyl-3-pyrrolidinol

Sign In for Pricing
View Details