Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD6 Rabbit Polyclonal Antibody (HRP)

SMAD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AOVD2, MADH6, MADH7, HsT17432

UniProt

O43541

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conductivity Standard 111800 Microsiemense Nist Traceable Potassium Chloride
818966 500 mL

Conductivity Standard 111800 Microsiemense Nist Traceable Potassium Chloride

Sign In for Pricing
View Details
Ezrin (EZR) (NM_001111077) Human 3' UTR Clone
SC213101 10 µg

Ezrin (EZR) (NM_001111077) Human 3' UTR Clone

Sign In for Pricing
View Details
DLK1 Polyclonal Antibody
RD83918A-01 60μL

DLK1 Polyclonal Antibody

Sign In for Pricing
View Details
DLK1 Polyclonal Antibody
RD83918A-02 120μL

DLK1 Polyclonal Antibody

Sign In for Pricing
View Details
DLK1 Polyclonal Antibody
RD83918A-03 200μL

DLK1 Polyclonal Antibody

Sign In for Pricing
View Details
Lipase Endothelial (LIPG) Rabbit anti-Human Polyclonal (aa19-32) Antibody
GWB-C4A140 0.05 mg

Lipase Endothelial (LIPG) Rabbit anti-Human Polyclonal (aa19-32) Antibody

Sign In for Pricing
View Details