Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD1 Rabbit Polyclonal Antibody (HRP)

MBD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RFT, PCM1, CXXC3

UniProt

Q9UIS9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001191067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEBPE discontinued
387374 200 µL

CEBPE discontinued

Sign In for Pricing
View Details
FN3K Protein Vector (Mouse) (pPM-C-His)
PV179865 500 ng

FN3K Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Anti Human EIF3K Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8423712-01 0.12 mL

Rabbit Anti Human EIF3K Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human EIF3K Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8423712-02 0.2 mL

Rabbit Anti Human EIF3K Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human EIF3K Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8423712-03 5x 0.2 mL

Rabbit Anti Human EIF3K Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
MFSD12 Antibody Blocking Peptide
orb1500335 500 µg

MFSD12 Antibody Blocking Peptide

Sign In for Pricing
View Details