Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBL1 Rabbit Polyclonal Antibody (HRP)

MYBL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AMYB, A-MYB

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MYBL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

XP_948618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCL1 Peptide - middle region (AAP78085)
AAP78085-100UG 100 µg

MCL1 Peptide - middle region (AAP78085)

Sign In for Pricing
View Details
NADPH oxidase 4 Polyclonal Antibody, Cy5 Conjugated
bs-4730R-Cy5 100 µL

NADPH oxidase 4 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3091), 0.2mg/mL
BNUB3091-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3091), 0.2mg/mL

Sign In for Pricing
View Details
NSUN2 Rabbit mAb
A24132-01 20 µL

NSUN2 Rabbit mAb

Sign In for Pricing
View Details
NSUN2 Rabbit mAb
A24132-02 100 μL

NSUN2 Rabbit mAb

Sign In for Pricing
View Details
NSUN2 Rabbit mAb
A24132-03 500 μL

NSUN2 Rabbit mAb

Sign In for Pricing
View Details