Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF295 Rabbit Polyclonal Antibody (FITC)

ZNF295 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF295

UniProt

Q9ULJ3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF295

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065778

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP Kinase Interacting Serine/threonine Kinase 2, NT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (PE)
MBS6486648-01 0.2 mL

MAP Kinase Interacting Serine/threonine Kinase 2, NT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (PE)

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2, NT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (PE)
MBS6486648-02 5x 0.2 mL

MAP Kinase Interacting Serine/threonine Kinase 2, NT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (PE)

Sign In for Pricing
View Details
26S Proteasome α (IIG7) AC
sc-65755 AC 500 µg/mL - 25% ag

26S Proteasome α (IIG7) AC

Sign In for Pricing
View Details
Fam70a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4182903 1.0 µg DNA

Fam70a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TRPC1 shRNA (S. scrofa) Lentiviral Particles
sc-270467-V 200 µL

TRPC1 shRNA (S. scrofa) Lentiviral Particles

Sign In for Pricing
View Details
Phospho-NFKB p65 (Ser311) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb970734 100 µL

Phospho-NFKB p65 (Ser311) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details