Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAWR Rabbit Polyclonal Antibody (HRP)

PAWR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAR4, Par-4

UniProt

O75796

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAWR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sox13 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6446403 1.0 µg DNA

Sox13 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Laminin alpha 4 Rabbit Polyclonal Antibody (Cy3)
orb991317 100 µL

Laminin alpha 4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mouse Tacr2 activation kit by CRISPRa
GA204196 1 Kit

Mouse Tacr2 activation kit by CRISPRa

Sign In for Pricing
View Details
Scpep1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4950206 1.0 µg DNA

Scpep1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Odf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6398808 1.0 µg DNA

Odf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human Activating Transcription Factor 6 (ATF6) ELISA Kit
RD-ATF6-Hu-96Tests 96 Tests

Human Activating Transcription Factor 6 (ATF6) ELISA Kit

Sign In for Pricing
View Details