Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAWR Rabbit Polyclonal Antibody (Biotin)

PAWR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PAR4, Par-4

UniProt

O75796

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAWR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2,3-Dihydro-1,3-dioxo-5-sulfo-1H-inden-2-yl)-6,8-Quinolinedisulfonic acid trisodium salt
TRC-D589940-25MG 25 mg

2-(2,3-Dihydro-1,3-dioxo-5-sulfo-1H-inden-2-yl)-6,8-Quinolinedisulfonic acid trisodium salt

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), CF640R conjugate, 0.1mg/mL
BNC400120-100 1x 100 µL

Lung Specific Antigen (LSA120), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LOC283392 (NM_001025457) Human Recombinant Protein
TP310873 20 µg

LOC283392 (NM_001025457) Human Recombinant Protein

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-01 24 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-02 48 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-03 96 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details