Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOA2 Rabbit Polyclonal Antibody (HRP)

NCOA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRC2, TIF2, GRIP1, KAT13C, NCoA-2, bHLHe75

UniProt

Q15596

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NCOA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006531.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PD-1/PDCD1 Antibody Picoband®, APC Conjugate
A00178-APC 100 µg/Vial

Anti-PD-1/PDCD1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
ZBTB43 Polyclonal Antibody, Cy7 Conjugated
bs-13578R-Cy7 100 µL

ZBTB43 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Protein O-Fucosyltransferase 1 (POFUT1) Antibody
abx114820 100 µL

Protein O-Fucosyltransferase 1 (POFUT1) Antibody

Sign In for Pricing
View Details
Ost4 (NM_001134690) Rat Tagged ORF Clone Lentiviral Particle
RR200006L4V 200 µL

Ost4 (NM_001134690) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Latexin (LXN) Antibody
abx100110-01 100 µL

Latexin (LXN) Antibody

Sign In for Pricing
View Details
Latexin (LXN) Antibody
abx100110-02 200 µL

Latexin (LXN) Antibody

Sign In for Pricing
View Details