Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSBP Rabbit Polyclonal Antibody (HRP)

FSBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95073

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FSBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQS

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QueE Antibody
orb824916 2 mg

QueE Antibody

Sign In for Pricing
View Details
Triethylammonium bicarbonate buffer (1.0M pH 8.5)
HY-W694629-01 1 mL

Triethylammonium bicarbonate buffer (1.0M pH 8.5)

Sign In for Pricing
View Details
Triethylammonium bicarbonate buffer (1.0M pH 8.5)
HY-W694629-02 5 mL

Triethylammonium bicarbonate buffer (1.0M pH 8.5)

Sign In for Pricing
View Details
Triethylammonium bicarbonate buffer (1.0M pH 8.5)
HY-W694629-03 10 mL

Triethylammonium bicarbonate buffer (1.0M pH 8.5)

Sign In for Pricing
View Details
PLK1 Rabbit Polyclonal Antibody
orb19485 100 µg

PLK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2- (2-Chloro-4-iodophenylamino) -3,4-difluorobenzoic acid
268247-01 10 mg

2- (2-Chloro-4-iodophenylamino) -3,4-difluorobenzoic acid

Sign In for Pricing
View Details