Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACADM Rabbit Polyclonal Antibody (Biotin)

ACADM Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MCAD, ACAD1, MCADH

UniProt

P11310

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACADM

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_000007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC5A3 Rabbit Polyclonal Antibody (HRP)
orb470246 100 µL

SLC5A3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (Biotin)
MBS6393103-01 0.1 mL

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (Biotin)

Sign In for Pricing
View Details
RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (Biotin)
MBS6393103-02 5x 0.1 mL

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (Biotin)

Sign In for Pricing
View Details
XRCC3 peptide
orb218099-01 1 mg

XRCC3 peptide

Sign In for Pricing
View Details
XRCC3 peptide
orb218099-02 5 mg

XRCC3 peptide

Sign In for Pricing
View Details
Tetramethylbenizidine IHC Peroxidase
orb2652873 500 mL

Tetramethylbenizidine IHC Peroxidase

Sign In for Pricing
View Details