Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LBX1 Rabbit Polyclonal Antibody (Biotin)

LBX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HPX6, HPX-6, LBX1H, homeobox

UniProt

P52954

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LBX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A3 discontinued
394481 200 µL

SLC22A3 discontinued

Sign In for Pricing
View Details
Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit
MBS2031879-01 24 Strip Well

Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit

Sign In for Pricing
View Details
Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit
MBS2031879-02 48 Strip Well

Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit

Sign In for Pricing
View Details
Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit
MBS2031879-03 96 Strip Well

Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit

Sign In for Pricing
View Details
Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit
MBS2031879-04 5x 96 Strip Well

Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit

Sign In for Pricing
View Details
Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit
MBS2031879-05 10x 96 Strip Well

Human IBA57, Iron Sulfur Cluster Assembly Factor Homolog (IBA57) ELISA Kit

Sign In for Pricing
View Details