Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF1 Rabbit Polyclonal Antibody (Biotin)

KLF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EKLF, EKLF/KLF1

UniProt

Q13351

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KLF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_006554

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0B, ID (ATP6V0B, ATP6F, V-type proton ATPase 21kD proteolipid subunit, Vacuolar proton pump 21kD proteolipid subunit, hATPL) (AP)
MBS6276634-01 0.2 mL

ATP6V0B, ID (ATP6V0B, ATP6F, V-type proton ATPase 21kD proteolipid subunit, Vacuolar proton pump 21kD proteolipid subunit, hATPL) (AP)

Sign In for Pricing
View Details
ATP6V0B, ID (ATP6V0B, ATP6F, V-type proton ATPase 21kD proteolipid subunit, Vacuolar proton pump 21kD proteolipid subunit, hATPL) (AP)
MBS6276634-02 5x 0.2 mL

ATP6V0B, ID (ATP6V0B, ATP6F, V-type proton ATPase 21kD proteolipid subunit, Vacuolar proton pump 21kD proteolipid subunit, hATPL) (AP)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)
MBS1397342-01 0.02 mg (E-Coli)

Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)
MBS1397342-02 0.1 mg (E-Coli)

Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)
MBS1397342-03 0.02 mg (Yeast)

Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)
MBS1397342-04 0.1 mg (Yeast)

Recombinant Human Uncharacterized protein UNQ511/PRO1026 (UNQ511/PRO1026)

Sign In for Pricing
View Details