Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCERG1 Rabbit Polyclonal Antibody (FITC)

TCERG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Urn1, CA150, TAF2S

UniProt

O14776

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCERG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

124kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLOCK Rabbit Polyclonal Antibody (APC)
orb999604 100 µL

CLOCK Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
GPRC5C Recombinant Protein (Mouse)
RP139775 100 µg

GPRC5C Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Bim (phospho-Ser77) rabbit pAb Antibody
orb1097213-01 50 μL

Bim (phospho-Ser77) rabbit pAb Antibody

Sign In for Pricing
View Details
Bim (phospho-Ser77) rabbit pAb Antibody
orb1097213-02 100 µL

Bim (phospho-Ser77) rabbit pAb Antibody

Sign In for Pricing
View Details
Mouse Synaptonemal complex central element protein 2, SYCE2 ELISA Kit
MBS9326306-01 48 Well

Mouse Synaptonemal complex central element protein 2, SYCE2 ELISA Kit

Sign In for Pricing
View Details
Mouse Synaptonemal complex central element protein 2, SYCE2 ELISA Kit
MBS9326306-02 96 Well

Mouse Synaptonemal complex central element protein 2, SYCE2 ELISA Kit

Sign In for Pricing
View Details