Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORF4L1 Rabbit Polyclonal Antibody (Biotin)

MORF4L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15

UniProt

A5D8W6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MORF4L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D2 (BSA & Azide Free) (MaxLight 490)
MBS6267338-01 0.1 mL

Cyclin D2 (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Cyclin D2 (BSA & Azide Free) (MaxLight 490)
MBS6267338-02 5x 0.1 mL

Cyclin D2 (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Mouse F-box only protein 9 (Fbxo9)
MBS1372206-01 0.02 mg (E-Coli)

Recombinant Mouse F-box only protein 9 (Fbxo9)

Sign In for Pricing
View Details
Recombinant Mouse F-box only protein 9 (Fbxo9)
MBS1372206-02 0.02 mg (Yeast)

Recombinant Mouse F-box only protein 9 (Fbxo9)

Sign In for Pricing
View Details
Recombinant Mouse F-box only protein 9 (Fbxo9)
MBS1372206-03 0.1 mg (E-Coli)

Recombinant Mouse F-box only protein 9 (Fbxo9)

Sign In for Pricing
View Details
Recombinant Mouse F-box only protein 9 (Fbxo9)
MBS1372206-04 0.1 mg (Yeast)

Recombinant Mouse F-box only protein 9 (Fbxo9)

Sign In for Pricing
View Details