Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORF4L1 Rabbit Polyclonal Antibody (Biotin)

MORF4L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15

UniProt

Q86YT7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MORF4L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Protein Tyrosine Phosphatase 1B ELISA Kit
MBS010205-01 48 Well

Porcine Protein Tyrosine Phosphatase 1B ELISA Kit

Sign In for Pricing
View Details
Porcine Protein Tyrosine Phosphatase 1B ELISA Kit
MBS010205-02 96 Well

Porcine Protein Tyrosine Phosphatase 1B ELISA Kit

Sign In for Pricing
View Details
Porcine Protein Tyrosine Phosphatase 1B ELISA Kit
MBS010205-03 5x 96 Well

Porcine Protein Tyrosine Phosphatase 1B ELISA Kit

Sign In for Pricing
View Details
Porcine Protein Tyrosine Phosphatase 1B ELISA Kit
MBS010205-04 10x 96 Well

Porcine Protein Tyrosine Phosphatase 1B ELISA Kit

Sign In for Pricing
View Details
3-[ (2,5-Dimethylphenyl) amino]propanenitrile
LBA07216-01 0.5 g

3-[ (2,5-Dimethylphenyl) amino]propanenitrile

Sign In for Pricing
View Details
3-[ (2,5-Dimethylphenyl) amino]propanenitrile
LBA07216-02 5 g

3-[ (2,5-Dimethylphenyl) amino]propanenitrile

Sign In for Pricing
View Details