Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS5 Rabbit Polyclonal Antibody (Biotin)

COPS5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CSN5, JAB1, SGN5, MOV-34

UniProt

Q92905

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human COPS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVM

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_006828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP4, Phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 550)
MBS6475649-01 0.1 mL

FABP4, Phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 550)

Sign In for Pricing
View Details
FABP4, Phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 550)
MBS6475649-02 5x 0.1 mL

FABP4, Phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human CACNA2D4 shRNA (UAS) - Lentiviral human CACNA2D4 shRNA (UAS, GFP) (100)
GTR15163281 1 Vial

Lentiviral human CACNA2D4 shRNA (UAS) - Lentiviral human CACNA2D4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
LdrB Antibody
orb820500 2 mg

LdrB Antibody

Sign In for Pricing
View Details
Flat One Piece Stainless Steel Lid with Insulated Handle to suit 22 Litre Capacity Bath
BAT7358 1 Each

Flat One Piece Stainless Steel Lid with Insulated Handle to suit 22 Litre Capacity Bath

Sign In for Pricing
View Details
ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (AP)
MBS6464077-01 0.2 mL

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (AP)

Sign In for Pricing
View Details