Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALF Rabbit Polyclonal Antibody (HRP)

ALF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALF

UniProt

Q9UNN4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_751946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-YA (G-2) PE
sc-17753 PE 200 µg/mL

NF-YA (G-2) PE

Sign In for Pricing
View Details
CLPB, CT (CLPB, HSP78, SKD3, Caseinolytic peptidase B protein homolog, Suppressor of potassium transport defect 3) (MaxLight 650) discontinued
034009-ML650 100 µL

CLPB, CT (CLPB, HSP78, SKD3, Caseinolytic peptidase B protein homolog, Suppressor of potassium transport defect 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Rfxank Pre-designed siRNA Set A
SI111914A 1 Each

Mouse Rfxank Pre-designed siRNA Set A

Sign In for Pricing
View Details
MYLK Polyclonal Antibody
E44H05389 100 µL

MYLK Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human LHCGR sgRNA gene knockout kit - Lentiviral human LHCGR sgRNA gene knockout kit (100)
GTR15387502 1 Vial

Lentiviral human LHCGR sgRNA gene knockout kit - Lentiviral human LHCGR sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ABCA9 Polyclonal Antibody
MBS8529811-01 0.1 mg

ABCA9 Polyclonal Antibody

Sign In for Pricing
View Details