Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALF Rabbit Polyclonal Antibody (Biotin)

ALF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALF

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_751946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6875-3p inhibitor
HY-RI02310-01 5 nmol

Hsa-miR-6875-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-6875-3p inhibitor
HY-RI02310-02 20 nmol

Hsa-miR-6875-3p inhibitor

Sign In for Pricing
View Details
SPDEF sgRNA CRISPR Lentivector (Human) (Target 1)
K2269902 1.0 µg DNA

SPDEF sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Sulfosuccinimidyl elaidate sodium
sc-474619 25 mg

Sulfosuccinimidyl elaidate sodium

Sign In for Pricing
View Details
CDK18 Antibody
orb1285871 100 µL

CDK18 Antibody

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (Biotin)
246270-Biotin 100 µL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (Biotin)

Sign In for Pricing
View Details